TNFRSF12A monoclonal antibody (M01), clone 1B6 View larger

TNFRSF12A monoclonal antibody (M01), clone 1B6

H00051330-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF12A monoclonal antibody (M01), clone 1B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TNFRSF12A monoclonal antibody (M01), clone 1B6

Brand: Abnova
Reference: H00051330-M01
Product name: TNFRSF12A monoclonal antibody (M01), clone 1B6
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF12A.
Clone: 1B6
Isotype: IgG2a Kappa
Gene id: 51330
Gene name: TNFRSF12A
Gene alias: CD266|FN14|TWEAKR
Gene description: tumor necrosis factor receptor superfamily, member 12A
Genbank accession: BC002718
Immunogen: TNFRSF12A (AAH02718, 28 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Protein accession: AAH02718
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051330-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TNFRSF12A is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TNFRSF12A monoclonal antibody (M01), clone 1B6 now

Add to cart