H00051330-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00051330-M01 |
Product name: | TNFRSF12A monoclonal antibody (M01), clone 1B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF12A. |
Clone: | 1B6 |
Isotype: | IgG2a Kappa |
Gene id: | 51330 |
Gene name: | TNFRSF12A |
Gene alias: | CD266|FN14|TWEAKR |
Gene description: | tumor necrosis factor receptor superfamily, member 12A |
Genbank accession: | BC002718 |
Immunogen: | TNFRSF12A (AAH02718, 28 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Protein accession: | AAH02718 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged TNFRSF12A is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |