ERAF monoclonal antibody (M32), clone 2E4 View larger

ERAF monoclonal antibody (M32), clone 2E4

H00051327-M32_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERAF monoclonal antibody (M32), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ERAF monoclonal antibody (M32), clone 2E4

Brand: Abnova
Reference: H00051327-M32
Product name: ERAF monoclonal antibody (M32), clone 2E4
Product description: Mouse monoclonal antibody raised against a full-length recombinant ERAF.
Clone: 2E4
Isotype: IgG1 Kappa
Gene id: 51327
Gene name: ERAF
Gene alias: AHSP|EDRF
Gene description: erythroid associated factor
Genbank accession: NM_016633.2
Immunogen: ERAF (NP_057717.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Protein accession: NP_057717.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051327-M32-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051327-M32-13-15-1.jpg
Application image note: Western Blot analysis of ERAF expression in transfected 293T cell line by ERAF monoclonal antibody (M32), clone 2E4.

Lane 1: ERAF transfected lysate(11.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ERAF monoclonal antibody (M32), clone 2E4 now

Add to cart