PHF21A monoclonal antibody (M01), clone 5A6 View larger

PHF21A monoclonal antibody (M01), clone 5A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF21A monoclonal antibody (M01), clone 5A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PHF21A monoclonal antibody (M01), clone 5A6

Brand: Abnova
Reference: H00051317-M01
Product name: PHF21A monoclonal antibody (M01), clone 5A6
Product description: Mouse monoclonal antibody raised against a partial recombinant PHF21A.
Clone: 5A6
Isotype: IgG1 Kappa
Gene id: 51317
Gene name: PHF21A
Gene alias: BHC80|BM-006|KIAA1696
Gene description: PHD finger protein 21A
Genbank accession: NM_016621
Immunogen: PHF21A (NP_057705, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA
Protein accession: NP_057705
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051317-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051317-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PHF21A is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PHF21A monoclonal antibody (M01), clone 5A6 now

Add to cart