Brand: | Abnova |
Reference: | H00051314-M01 |
Product name: | TXNDC3 monoclonal antibody (M01), clone 1G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TXNDC3. |
Clone: | 1G5 |
Isotype: | IgG2a Kappa |
Gene id: | 51314 |
Gene name: | TXNDC3 |
Gene alias: | CILD6|NME8|SPTRX2 |
Gene description: | thioredoxin domain containing 3 (spermatozoa) |
Genbank accession: | NM_016616 |
Immunogen: | TXNDC3 (NP_057700, 530 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE |
Protein accession: | NP_057700 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TXNDC3 monoclonal antibody (M01), clone 1G5. Western Blot analysis of TXNDC3 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |