Brand: | Abnova |
Reference: | H00051296-M04 |
Product name: | SLC15A3 monoclonal antibody (M04), clone 5B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC15A3. |
Clone: | 5B4 |
Isotype: | IgG2b Kappa |
Gene id: | 51296 |
Gene name: | SLC15A3 |
Gene alias: | FLJ26631|OCTP|PHT2|PTR3|hPTR3 |
Gene description: | solute carrier family 15, member 3 |
Genbank accession: | NM_016582 |
Immunogen: | SLC15A3 (NP_057666.1, 254 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ |
Protein accession: | NP_057666.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |