Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD320 monoclonal antibody (M04A), clone 4F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CD320 monoclonal antibody (M04A), clone 4F2
| Brand: | Abnova |
| Reference: | H00051293-M04A |
| Product name: | CD320 monoclonal antibody (M04A), clone 4F2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CD320. |
| Clone: | 4F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51293 |
| Gene name: | CD320 |
| Gene alias: | 8D6|8D6A |
| Gene description: | CD320 molecule |
| Genbank accession: | BC000668 |
| Immunogen: | CD320 (AAH00668, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP |
| Protein accession: | AAH00668 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (56.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |