TLR7 monoclonal antibody (M10), clone 1G8 View larger

TLR7 monoclonal antibody (M10), clone 1G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR7 monoclonal antibody (M10), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TLR7 monoclonal antibody (M10), clone 1G8

Brand: Abnova
Reference: H00051284-M10
Product name: TLR7 monoclonal antibody (M10), clone 1G8
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR7.
Clone: 1G8
Isotype: IgG2a Kappa
Gene id: 51284
Gene name: TLR7
Gene alias: -
Gene description: toll-like receptor 7
Genbank accession: NM_016562
Immunogen: TLR7 (NP_057646, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL
Protein accession: NP_057646
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051284-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051284-M10-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TLR7 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLR7 monoclonal antibody (M10), clone 1G8 now

Add to cart