Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051280-M06A |
Product name: | GOLM1 monoclonal antibody (M06A), clone 5B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GOLM1. |
Clone: | 5B10 |
Isotype: | IgG1 Kappa |
Gene id: | 51280 |
Gene name: | GOLM1 |
Gene alias: | C9orf155|FLJ22634|FLJ23608|GOLPH2|GP73|PSEC0257|bA379P1.3 |
Gene description: | golgi membrane protein 1 |
Genbank accession: | NM_016548 |
Immunogen: | GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
Protein accession: | NP_057632 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 monoclonal antibody (M06A), clone 5B10. Lane 1: GOLM1 transfected lysate(45.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |