Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051257-M04 |
Product name: | MARCH2 monoclonal antibody (M04), clone 7F3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MARCH2. |
Clone: | 7F3 |
Isotype: | IgG2a Kappa |
Gene id: | 51257 |
Gene name: | MARCH2 |
Gene alias: | HSPC240|MARCH-II|RNF172 |
Gene description: | membrane-associated ring finger (C3HC4) 2 |
Genbank accession: | NM_001005416.1 |
Immunogen: | MARCH2 (NP_001005416.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV |
Protein accession: | NP_001005416.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of 2-Mar expression in transfected 293T cell line by MARCH2 monoclonal antibody (M04), clone 7F3. Lane 1: 2-Mar transfected lysate(19.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |