CRIM1 monoclonal antibody (M01), clone 6E4 View larger

CRIM1 monoclonal antibody (M01), clone 6E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRIM1 monoclonal antibody (M01), clone 6E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about CRIM1 monoclonal antibody (M01), clone 6E4

Brand: Abnova
Reference: H00051232-M01
Product name: CRIM1 monoclonal antibody (M01), clone 6E4
Product description: Mouse monoclonal antibody raised against a partial recombinant CRIM1.
Clone: 6E4
Isotype: IgG2a Kappa
Gene id: 51232
Gene name: CRIM1
Gene alias: MGC138194|S52
Gene description: cysteine rich transmembrane BMP regulator 1 (chordin-like)
Genbank accession: NM_016441
Immunogen: CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Protein accession: NP_057525
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051232-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051232-M01-3-1-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CRIM1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CRIM1 monoclonal antibody (M01), clone 6E4 now

Add to cart