Brand: | Abnova |
Reference: | H00051209-M04 |
Product name: | RAB9B monoclonal antibody (M04), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB9B. |
Clone: | 3C9 |
Isotype: | IgG2a Kappa |
Gene id: | 51209 |
Gene name: | RAB9B |
Gene alias: | RAB9L |
Gene description: | RAB9B, member RAS oncogene family |
Genbank accession: | NM_016370 |
Immunogen: | RAB9B (NP_057454, 102 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC |
Protein accession: | NP_057454 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RAB9B on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |