Brand: | Abnova |
Reference: | H00051187-M01 |
Product name: | C15orf15 monoclonal antibody (M01), clone 2A10-1E5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant C15orf15. |
Clone: | 2A10-1E5 |
Isotype: | IgG1 kappa |
Gene id: | 51187 |
Gene name: | C15orf15 |
Gene alias: | HRP-L30-iso|L30|RLP24|RPL24|RPL24L|TVAS3 |
Gene description: | chromosome 15 open reading frame 15 |
Genbank accession: | BC005344 |
Immunogen: | C15orf15 (AAH05344, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV |
Protein accession: | AAH05344 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to C15orf15 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |