DCXR monoclonal antibody (M03), clone 6A6 View larger

DCXR monoclonal antibody (M03), clone 6A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCXR monoclonal antibody (M03), clone 6A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,ELISA,WB-Re

More info about DCXR monoclonal antibody (M03), clone 6A6

Brand: Abnova
Reference: H00051181-M03
Product name: DCXR monoclonal antibody (M03), clone 6A6
Product description: Mouse monoclonal antibody raised against a partial recombinant DCXR.
Clone: 6A6
Isotype: IgG1 Kappa
Gene id: 51181
Gene name: DCXR
Gene alias: DCR|HCR2|HCRII|KIDCR|P34H|SDR20C1
Gene description: dicarbonyl/L-xylulose reductase
Genbank accession: NM_016286
Immunogen: DCXR (NP_057370, 145 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC
Protein accession: NP_057370
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051181-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051181-M03-1-4-1.jpg
Application image note: DCXR monoclonal antibody (M03), clone 6A6 Western Blot analysis of DCXR expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DCXR monoclonal antibody (M03), clone 6A6 now

Add to cart