LEF1 monoclonal antibody (M10), clone 3A2 View larger

LEF1 monoclonal antibody (M10), clone 3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LEF1 monoclonal antibody (M10), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about LEF1 monoclonal antibody (M10), clone 3A2

Brand: Abnova
Reference: H00051176-M10
Product name: LEF1 monoclonal antibody (M10), clone 3A2
Product description: Mouse monoclonal antibody raised against a full length recombinant LEF1.
Clone: 3A2
Isotype: IgG2a Kappa
Gene id: 51176
Gene name: LEF1
Gene alias: DKFZp586H0919|TCF1ALPHA
Gene description: lymphoid enhancer-binding factor 1
Genbank accession: NM_016269
Immunogen: LEF1 (NP_057353, 33 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
Protein accession: NP_057353
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051176-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051176-M10-13-15-1.jpg
Application image note: Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M10), clone 3A2.

Lane 1: LEF1 transfected lysate(44.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LEF1 monoclonal antibody (M10), clone 3A2 now

Add to cart