EGFL7 MaxPab rabbit polyclonal antibody (D01) View larger

EGFL7 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGFL7 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr,IP

More info about EGFL7 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00051162-D01
Product name: EGFL7 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human EGFL7 protein.
Gene id: 51162
Gene name: EGFL7
Gene alias: MGC111117|RP11-251M1.2|VE-STATIN|ZNEU1
Gene description: EGF-like-domain, multiple 7
Genbank accession: NM_016215.3
Immunogen: EGFL7 (NP_057299.1, 1 a.a. ~ 273 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Protein accession: NP_057299.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051162-D01-2-A8-1.jpg
Application image note: EGFL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of EGFL7 expression in human placenta.
Applications: WB-Ce,WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy EGFL7 MaxPab rabbit polyclonal antibody (D01) now

Add to cart