EGFL7 purified MaxPab mouse polyclonal antibody (B01P) View larger

EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051162-B01P
Product name: EGFL7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human EGFL7 protein.
Gene id: 51162
Gene name: EGFL7
Gene alias: MGC111117|RP11-251M1.2|VE-STATIN|ZNEU1
Gene description: EGF-like-domain, multiple 7
Genbank accession: NM_016215.3
Immunogen: EGFL7 (NP_057299.1, 1 a.a. ~ 273 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Protein accession: NP_057299.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051162-B01P-13-15-1.jpg
Application image note: Western Blot analysis of EGFL7 expression in transfected 293T cell line (H00051162-T01) by EGFL7 MaxPab polyclonal antibody.

Lane 1: EGFL7 transfected lysate(30.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EGFL7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart