Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051162-B01P |
Product name: | EGFL7 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human EGFL7 protein. |
Gene id: | 51162 |
Gene name: | EGFL7 |
Gene alias: | MGC111117|RP11-251M1.2|VE-STATIN|ZNEU1 |
Gene description: | EGF-like-domain, multiple 7 |
Genbank accession: | NM_016215.3 |
Immunogen: | EGFL7 (NP_057299.1, 1 a.a. ~ 273 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS |
Protein accession: | NP_057299.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EGFL7 expression in transfected 293T cell line (H00051162-T01) by EGFL7 MaxPab polyclonal antibody. Lane 1: EGFL7 transfected lysate(30.03 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |