Brand: | Abnova |
Reference: | H00051154-M01 |
Product name: | C1orf33 monoclonal antibody (M01), clone 1C12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant C1orf33. |
Clone: | 1C12 |
Isotype: | IgG1 kappa |
Gene id: | 51154 |
Gene name: | MRTO4 |
Gene alias: | C1orf33|MRT4|dJ657E11.4 |
Gene description: | mRNA turnover 4 homolog (S. cerevisiae) |
Genbank accession: | BC003013 |
Immunogen: | C1orf33 (AAH03013, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD |
Protein accession: | AAH03013 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (52.03 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to C1orf33 on HepG2 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |