MRTO4 MaxPab rabbit polyclonal antibody (D01) View larger

MRTO4 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRTO4 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about MRTO4 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00051154-D01
Product name: MRTO4 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human MRTO4 protein.
Gene id: 51154
Gene name: MRTO4
Gene alias: C1orf33|MRT4|dJ657E11.4
Gene description: mRNA turnover 4 homolog (S. cerevisiae)
Genbank accession: NM_016183
Immunogen: MRTO4 (NP_057267.2, 1 a.a. ~ 239 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
Protein accession: NP_057267.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051154-D01-31-15-1.jpg
Application image note: Immunoprecipitation of MRTO4 transfected lysate using anti-MRTO4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MRTO4 MaxPab mouse polyclonal antibody (B01) (H00051154-B01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy MRTO4 MaxPab rabbit polyclonal antibody (D01) now

Add to cart