Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C1orf33 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about C1orf33 MaxPab mouse polyclonal antibody (B01)
| Product description: | Mouse polyclonal antibody raised against a full-length human C1orf33 protein. |
| Gene id: | 51154 |
| Gene name: | MRTO4 |
| Gene alias: | C1orf33|MRT4|dJ657E11.4 |
| Gene description: | mRNA turnover 4 homolog (S. cerevisiae) |
| Genbank accession: | NM_016183 |
| Immunogen: | C1orf33 (NP_057267, 1 a.a. ~ 239 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD |
| Protein accession: | NP_057267 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Size: | 50 uL |
| Shipping condition: | Dry Ice |