SLC45A2 monoclonal antibody (M02), clone 1B2 View larger

SLC45A2 monoclonal antibody (M02), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC45A2 monoclonal antibody (M02), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC45A2 monoclonal antibody (M02), clone 1B2

Brand: Abnova
Reference: H00051151-M02
Product name: SLC45A2 monoclonal antibody (M02), clone 1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant SLC45A2.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 51151
Gene name: SLC45A2
Gene alias: 1A1|AIM1|MATP|SHEP5
Gene description: solute carrier family 45, member 2
Genbank accession: BC003597
Immunogen: SLC45A2 (AAH03597, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL
Protein accession: AAH03597
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051151-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051151-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC45A2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC45A2 monoclonal antibody (M02), clone 1B2 now

Add to cart