Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC45A2 monoclonal antibody (M01), clone 2F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about SLC45A2 monoclonal antibody (M01), clone 2F4
| Brand: | Abnova |
| Reference: | H00051151-M01 |
| Product name: | SLC45A2 monoclonal antibody (M01), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SLC45A2. |
| Clone: | 2F4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 51151 |
| Gene name: | SLC45A2 |
| Gene alias: | 1A1|AIM1|MATP|SHEP5 |
| Gene description: | solute carrier family 45, member 2 |
| Genbank accession: | BC003597 |
| Immunogen: | SLC45A2 (AAH03597, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL |
| Protein accession: | AAH03597 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.47 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MATP monoclonal antibody (M01), clone 2F4 Western Blot analysis of MATP expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Membrane-Associated Transporter Protein (MATP) Regulates Melanosomal pH and Influences Tyrosinase Activity.Bin BH, Bhin J, Yang SH, Shin M, Nam YJ, Choi DH, Shin DW, Lee AY, Hwang D, Cho EG, Lee TR. PLoS One. 2015 Jun 9;10(6):e0129273. |