HSD17B12 monoclonal antibody (M08), clone 4G11 View larger

HSD17B12 monoclonal antibody (M08), clone 4G11

H00051144-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B12 monoclonal antibody (M08), clone 4G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA

More info about HSD17B12 monoclonal antibody (M08), clone 4G11

Brand: Abnova
Reference: H00051144-M08
Product name: HSD17B12 monoclonal antibody (M08), clone 4G11
Product description: Mouse monoclonal antibody raised against a partial recombinant HSD17B12.
Clone: 4G11
Isotype: IgG2b Kappa
Gene id: 51144
Gene name: HSD17B12
Gene alias: KAR|SDR12C1
Gene description: hydroxysteroid (17-beta) dehydrogenase 12
Genbank accession: NM_016142
Immunogen: HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Protein accession: NP_057226
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00051144-M08-1-6-1.jpg
Application image note: HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HSD17B12 monoclonal antibody (M08), clone 4G11 now

Add to cart