LOC51136 monoclonal antibody (M01), clone 4H7 View larger

LOC51136 monoclonal antibody (M01), clone 4H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC51136 monoclonal antibody (M01), clone 4H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about LOC51136 monoclonal antibody (M01), clone 4H7

Brand: Abnova
Reference: H00051136-M01
Product name: LOC51136 monoclonal antibody (M01), clone 4H7
Product description: Mouse monoclonal antibody raised against a partial recombinant LOC51136.
Clone: 4H7
Isotype: IgG2a Kappa
Gene id: 51136
Gene name: RNFT1
Gene alias: MGC111090|PTD016
Gene description: ring finger protein, transmembrane 1
Genbank accession: NM_016125
Immunogen: LOC51136 (NP_057209, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG
Protein accession: NP_057209
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051136-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051136-M01-13-15-1.jpg
Application image note: Western Blot analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody (M01), clone 4H7.

Lane 1: LOC51136 transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC51136 monoclonal antibody (M01), clone 4H7 now

Add to cart