IRAK4 monoclonal antibody (M11), clone 4E8 View larger

IRAK4 monoclonal antibody (M11), clone 4E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRAK4 monoclonal antibody (M11), clone 4E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IRAK4 monoclonal antibody (M11), clone 4E8

Brand: Abnova
Reference: H00051135-M11
Product name: IRAK4 monoclonal antibody (M11), clone 4E8
Product description: Mouse monoclonal antibody raised against a full length recombinant IRAK4.
Clone: 4E8
Isotype: IgG2a Kappa
Gene id: 51135
Gene name: IRAK4
Gene alias: IPD1|NY-REN-64|REN64
Gene description: interleukin-1 receptor-associated kinase 4
Genbank accession: NM_016123
Immunogen: IRAK4 (NP_057207, 255 a.a. ~ 351 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT
Protein accession: NP_057207
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051135-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051135-M11-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IRAK4 monoclonal antibody (M11), clone 4E8 now

Add to cart