RNF12 monoclonal antibody (M01), clone 1G10 View larger

RNF12 monoclonal antibody (M01), clone 1G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF12 monoclonal antibody (M01), clone 1G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about RNF12 monoclonal antibody (M01), clone 1G10

Brand: Abnova
Reference: H00051132-M01
Product name: RNF12 monoclonal antibody (M01), clone 1G10
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF12.
Clone: 1G10
Isotype: IgG2a Kappa
Gene id: 51132
Gene name: RNF12
Gene alias: MGC15161|NY-REN-43|RLIM
Gene description: ring finger protein 12
Genbank accession: NM_016120
Immunogen: RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Protein accession: NP_057204
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051132-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051132-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse.Federici F, Magaraki A, Wassenaar E, van Veen-Buurman CJ, van de Werken C, Baart EB, Laven JS, Grootegoed JA, Gribnau J, Baarends WM.
PLoS Genet. 2016 Oct 7;12(10):e1006358.

Reviews

Buy RNF12 monoclonal antibody (M01), clone 1G10 now

Add to cart