Brand: | Abnova |
Reference: | H00051132-M01 |
Product name: | RNF12 monoclonal antibody (M01), clone 1G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF12. |
Clone: | 1G10 |
Isotype: | IgG2a Kappa |
Gene id: | 51132 |
Gene name: | RNF12 |
Gene alias: | MGC15161|NY-REN-43|RLIM |
Gene description: | ring finger protein 12 |
Genbank accession: | NM_016120 |
Immunogen: | RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN |
Protein accession: | NP_057204 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse.Federici F, Magaraki A, Wassenaar E, van Veen-Buurman CJ, van de Werken C, Baart EB, Laven JS, Grootegoed JA, Gribnau J, Baarends WM. PLoS Genet. 2016 Oct 7;12(10):e1006358. |