PHF11 monoclonal antibody (M01), clone 3B8 View larger

PHF11 monoclonal antibody (M01), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF11 monoclonal antibody (M01), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PHF11 monoclonal antibody (M01), clone 3B8

Brand: Abnova
Reference: H00051131-M01
Product name: PHF11 monoclonal antibody (M01), clone 3B8
Product description: Mouse monoclonal antibody raised against a full-length recombinant PHF11.
Clone: 3B8
Isotype: IgG2a Kappa
Gene id: 51131
Gene name: PHF11
Gene alias: APY|BCAP|IGEL|IGER|IGHER|NY-REN-34|NYREN34
Gene description: PHD finger protein 11
Genbank accession: BC017212
Immunogen: PHF11 (AAH17212, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY
Protein accession: AAH17212
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051131-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051131-M01-13-15-1.jpg
Application image note: Western Blot analysis of PHF11 expression in transfected 293T cell line by PHF11 monoclonal antibody (M01), clone 3B8.

Lane 1: PHF11 transfected lysate(33.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PHF11 monoclonal antibody (M01), clone 3B8 now

Add to cart