ANGPTL4 (Human) Recombinant Protein (P01) View larger

ANGPTL4 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL4 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ANGPTL4 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00051129-P01
Product name: ANGPTL4 (Human) Recombinant Protein (P01)
Product description: Human ANGPTL4 full-length ORF ( AAH23647.1, 26 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 51129
Gene name: ANGPTL4
Gene alias: ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158
Gene description: angiopoietin-like 4
Genbank accession: BC023647
Immunogen sequence/protein sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS
Protein accession: AAH23647.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00051129-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Enhanced Angiogenesis in Obesity and in Response to PPAR{gamma} Activators Through Adipocyte VEGF and ANGPTL4 Production.Gealekman O, Burkart A, Chouinard M, Nicoloro S, Straubhaar J, Corvera S.
Am J Physiol Endocrinol Metab. 2008 Nov;295(5):E1056-64. Epub 2008 Aug 26.

Reviews

Buy ANGPTL4 (Human) Recombinant Protein (P01) now

Add to cart