ANGPTL4 monoclonal antibody (M03), clone 1F19 View larger

ANGPTL4 monoclonal antibody (M03), clone 1F19

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL4 monoclonal antibody (M03), clone 1F19

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ANGPTL4 monoclonal antibody (M03), clone 1F19

Brand: Abnova
Reference: H00051129-M03
Product name: ANGPTL4 monoclonal antibody (M03), clone 1F19
Product description: Mouse monoclonal antibody raised against a full-length recombinant ANGPTL4.
Clone: 1F19
Isotype: IgG2b Kappa
Gene id: 51129
Gene name: ANGPTL4
Gene alias: ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158
Gene description: angiopoietin-like 4
Genbank accession: BC023647
Immunogen: ANGPTL4 (AAH23647.1, 26 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS
Protein accession: AAH23647.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051129-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ANGPTL4 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ANGPTL4 monoclonal antibody (M03), clone 1F19 now

Add to cart