ANGPTL4 monoclonal antibody (M02), clone 1A12 View larger

ANGPTL4 monoclonal antibody (M02), clone 1A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL4 monoclonal antibody (M02), clone 1A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about ANGPTL4 monoclonal antibody (M02), clone 1A12

Brand: Abnova
Reference: H00051129-M02
Product name: ANGPTL4 monoclonal antibody (M02), clone 1A12
Product description: Mouse monoclonal antibody raised against a full-length recombinant ANGPTL4.
Clone: 1A12
Isotype: IgG1 Kappa
Gene id: 51129
Gene name: ANGPTL4
Gene alias: ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158
Gene description: angiopoietin-like 4
Genbank accession: BC023647
Immunogen: ANGPTL4 (AAH23647.1, 26 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS
Protein accession: AAH23647.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051129-M02-31-15-1.jpg
Application image note: Immunoprecipitation of ANGPTL4 transfected lysate using anti-ANGPTL4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ANGPTL4 MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy ANGPTL4 monoclonal antibody (M02), clone 1A12 now

Add to cart