Cart 82 Product Products 38 987,00 € (empty)
No products
To be determined Shipping
38 987,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 82 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 38 987,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 38 987,00 €
Data sheet of ANGPTL4 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about ANGPTL4 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00051129-D01P |
| Product name: | ANGPTL4 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ANGPTL4 protein. |
| Gene id: | 51129 |
| Gene name: | ANGPTL4 |
| Gene alias: | ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158 |
| Gene description: | angiopoietin-like 4 |
| Genbank accession: | NM_139314 |
| Immunogen: | ANGPTL4 (NP_647475.1, 1 a.a. ~ 406 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS |
| Protein accession: | NP_647475.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ANGPTL4 expression in transfected 293T cell line (H00051129-T02) by ANGPTL4 MaxPab polyclonal antibody. Lane 1: ANGPTL4 transfected lysate(45.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |