No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00051129-B01P |
Product name: | ANGPTL4 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ANGPTL4 protein. |
Gene id: | 51129 |
Gene name: | ANGPTL4 |
Gene alias: | ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158 |
Gene description: | angiopoietin-like 4 |
Genbank accession: | NM_139314 |
Immunogen: | ANGPTL4 (NP_647475.1, 1 a.a. ~ 406 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS |
Protein accession: | NP_647475.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of ANGPTL4 expression in transfected 293T cell line (H00051129-T02) by ANGPTL4 MaxPab polyclonal antibody. Lane 1: ANGPTL4 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | High Concentrations of Angiopoietin-Like Protein 4 Detected in Serum from Patients with Rheumatoid Arthritis Can Be Explained by Non-Specific Antibody Reactivity.Makoveichuk E, Ruge T, Nilsson S, Sodergren A, Olivecrona G. PLoS One. 2017 Jan 20;12(1):e0168922. |