Brand: | Abnova |
Reference: | H00051127-M03A |
Product name: | TRIM17 monoclonal antibody (M03A), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM17. |
Clone: | 2D3 |
Isotype: | IgG1 Kappa |
Gene id: | 51127 |
Gene name: | TRIM17 |
Gene alias: | RBCC|RNF16|terf |
Gene description: | tripartite motif-containing 17 |
Genbank accession: | NM_016102 |
Immunogen: | TRIM17 (NP_057186.1, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER |
Protein accession: | NP_057186.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |