TRIM17 monoclonal antibody (M02), clone 2C4 View larger

TRIM17 monoclonal antibody (M02), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM17 monoclonal antibody (M02), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TRIM17 monoclonal antibody (M02), clone 2C4

Brand: Abnova
Reference: H00051127-M02
Product name: TRIM17 monoclonal antibody (M02), clone 2C4
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM17.
Clone: 2C4
Isotype: IgG1 Kappa
Gene id: 51127
Gene name: TRIM17
Gene alias: RBCC|RNF16|terf
Gene description: tripartite motif-containing 17
Genbank accession: NM_016102
Immunogen: TRIM17 (NP_057186.1, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER
Protein accession: NP_057186.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051127-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051127-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIM17 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRIM17 monoclonal antibody (M02), clone 2C4 now

Add to cart