Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NAT5 monoclonal antibody (M01), clone 2C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about NAT5 monoclonal antibody (M01), clone 2C6
| Brand: | Abnova |
| Reference: | H00051126-M01 |
| Product name: | NAT5 monoclonal antibody (M01), clone 2C6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NAT5. |
| Clone: | 2C6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51126 |
| Gene name: | NAT5 |
| Gene alias: | NAT3|dJ1002M8.1 |
| Gene description: | N-acetyltransferase 5 (GCN5-related, putative) |
| Genbank accession: | BC005181 |
| Immunogen: | NAT5 (AAH05181, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE |
| Protein accession: | AAH05181 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NAT5 monoclonal antibody (M01), clone 2C6 Western Blot analysis of NAT5 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of the human Nalpha-acetyltransferase complex B (hNatB) - a complex important for cell cycle progression.Starheim KK, Arnesen T, Gromyko D, Ryningen A, Varhaug JE, Lillehaug J. Biochem J. 2008 Oct 15;415(2):325-31. |