GOLGA7 monoclonal antibody (M01), clone 2H8 View larger

GOLGA7 monoclonal antibody (M01), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GOLGA7 monoclonal antibody (M01), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,IP

More info about GOLGA7 monoclonal antibody (M01), clone 2H8

Brand: Abnova
Reference: H00051125-M01
Product name: GOLGA7 monoclonal antibody (M01), clone 2H8
Product description: Mouse monoclonal antibody raised against a full length recombinant GOLGA7.
Clone: 2H8
Isotype: IgG2a Kappa
Gene id: 51125
Gene name: GOLGA7
Gene alias: GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876
Gene description: golgi autoantigen, golgin subfamily a, 7
Genbank accession: BC012032
Immunogen: GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Protein accession: AAH12032
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051125-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.81 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051125-M01-1-2-1.jpg
Application image note: GOLGA7 monoclonal antibody (M01), clone 2H8 Western Blot analysis of GOLGA7 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice
Publications: Palmitoylation of oncogenic NRAS is essential for leukemogenesis.Cuiffo B, Ren R.
Blood. 2010 Apr 29;115(17):3598-605. Epub 2010 Mar 3.

Reviews

Buy GOLGA7 monoclonal antibody (M01), clone 2H8 now

Add to cart