View larger

GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00051125-D01P
Product name:	GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human GOLGA7 protein.
Gene id:	51125
Gene name:	GOLGA7
Gene alias:	GCP16\|GOLGA3AP1\|GOLGA7A\|HSPC041\|MGC21096\|MGC4876
Gene description:	golgi autoantigen, golgin subfamily a, 7
Genbank accession:	BC001227
Immunogen:	GOLGA7 (AAH01227.1, 1 a.a. ~ 134 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA
Protein accession:	AAH01227.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of GOLGA7 expression in transfected 293T cell line () by GOLGA7 MaxPab polyclonal antibody. Lane 1: GOLGA7 transfected lysate(15.60 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice