Brand: | Abnova |
Reference: | H00051110-M02 |
Product name: | LACTB2 monoclonal antibody (M02), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant LACTB2. |
Clone: | 1H3 |
Isotype: | IgG2a Kappa |
Gene id: | 51110 |
Gene name: | LACTB2 |
Gene alias: | CGI-83 |
Gene description: | lactamase, beta 2 |
Genbank accession: | NM_016027.1 |
Immunogen: | LACTB2 (NP_057111.1, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL |
Protein accession: | NP_057111.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (59.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LACTB2 monoclonal antibody (M02), clone 1H3. Western Blot analysis of LACTB2 expression in SK-BR-3. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |