LACTB2 monoclonal antibody (M02), clone 1H3 View larger

LACTB2 monoclonal antibody (M02), clone 1H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LACTB2 monoclonal antibody (M02), clone 1H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about LACTB2 monoclonal antibody (M02), clone 1H3

Brand: Abnova
Reference: H00051110-M02
Product name: LACTB2 monoclonal antibody (M02), clone 1H3
Product description: Mouse monoclonal antibody raised against a full-length recombinant LACTB2.
Clone: 1H3
Isotype: IgG2a Kappa
Gene id: 51110
Gene name: LACTB2
Gene alias: CGI-83
Gene description: lactamase, beta 2
Genbank accession: NM_016027.1
Immunogen: LACTB2 (NP_057111.1, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Protein accession: NP_057111.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051110-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051110-M02-1-10-1.jpg
Application image note: LACTB2 monoclonal antibody (M02), clone 1H3. Western Blot analysis of LACTB2 expression in SK-BR-3.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LACTB2 monoclonal antibody (M02), clone 1H3 now

Add to cart