Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RDH11 monoclonal antibody (M01), clone 1H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RDH11 monoclonal antibody (M01), clone 1H6
| Brand: | Abnova |
| Reference: | H00051109-M01 |
| Product name: | RDH11 monoclonal antibody (M01), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RDH11. |
| Clone: | 1H6 |
| Isotype: | IgG1 lambda |
| Gene id: | 51109 |
| Gene name: | RDH11 |
| Gene alias: | ARSDR1|CGI-82|FLJ32633|HCBP12|MDT1|PSDR1|RALR1|SCALD|SDR7C1 |
| Gene description: | retinol dehydrogenase 11 (all-trans/9-cis/11-cis) |
| Genbank accession: | BC000112 |
| Immunogen: | RDH11 (AAH00112, 24 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID |
| Protein accession: | AAH00112 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.19 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RDH11 monoclonal antibody (M01), clone 1H6 Western Blot analysis of RDH11 expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |