Cart 95 Product Products 37 380,14 € (empty)
No products
To be determined Shipping
37 380,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 95 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 380,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 380,14 €
Data sheet of PHF20L1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,WB-Tr |
More info about PHF20L1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00051105-B01P |
| Product name: | PHF20L1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PHF20L1 protein. |
| Gene id: | 51105 |
| Gene name: | PHF20L1 |
| Gene alias: | CGI-72|MGC64923 |
| Gene description: | PHD finger protein 20-like 1 |
| Genbank accession: | NM_198513.1 |
| Immunogen: | PHF20L1 (NP_940915.1, 1 a.a. ~ 285 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETAPMLEQV |
| Protein accession: | NP_940915.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PHF20L1 expression in transfected 293T cell line (H00051105-T01) by PHF20L1 MaxPab polyclonal antibody. Lane 1: PHF20L1 transfected lysate(31.35 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |