ABHD5 monoclonal antibody (M02), clone 4B12 View larger

ABHD5 monoclonal antibody (M02), clone 4B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABHD5 monoclonal antibody (M02), clone 4B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ABHD5 monoclonal antibody (M02), clone 4B12

Brand: Abnova
Reference: H00051099-M02
Product name: ABHD5 monoclonal antibody (M02), clone 4B12
Product description: Mouse monoclonal antibody raised against a partial recombinant ABHD5.
Clone: 4B12
Isotype: IgG1 Kappa
Gene id: 51099
Gene name: ABHD5
Gene alias: CDS|CGI58|IECN2|MGC8731|NCIE2
Gene description: abhydrolase domain containing 5
Genbank accession: NM_016006
Immunogen: ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK
Protein accession: NP_057090
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051099-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051099-M02-1-4-1.jpg
Application image note: ABHD5 monoclonal antibody (M02), clone 4B12 Western Blot analysis of ABHD5 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Adipose Triglyceride Lipase Regulation of Skeletal Muscle Lipid Metabolism and Insulin Responsiveness.Watt MJ, van Denderen BJ, Castelli LA, Bruce CR, Hoy AJ, Kraegen EW, Macaulay L, Kemp BE.
Mol Endocrinol. 2008 May;22(5):1200-12. Epub 2008 Jan 17.

Reviews

Buy ABHD5 monoclonal antibody (M02), clone 4B12 now

Add to cart