TRNT1 monoclonal antibody (M01), clone 1G11 View larger

TRNT1 monoclonal antibody (M01), clone 1G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRNT1 monoclonal antibody (M01), clone 1G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TRNT1 monoclonal antibody (M01), clone 1G11

Brand: Abnova
Reference: H00051095-M01
Product name: TRNT1 monoclonal antibody (M01), clone 1G11
Product description: Mouse monoclonal antibody raised against a full-length recombinant TRNT1.
Clone: 1G11
Isotype: IgG2b Kappa
Gene id: 51095
Gene name: TRNT1
Gene alias: CCA1|CGI-47|MtCCA
Gene description: tRNA nucleotidyl transferase, CCA-adding, 1
Genbank accession: BC012537
Immunogen: TRNT1 (AAH12537, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
Protein accession: AAH12537
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051095-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (70.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051095-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TRNT1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRNT1 monoclonal antibody (M01), clone 1G11 now

Add to cart