Brand: | Abnova |
Reference: | H00051094-M01 |
Product name: | ADIPOR1 monoclonal antibody (M01), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADIPOR1. |
Clone: | 2C8 |
Isotype: | IgG2b Kappa |
Gene id: | 51094 |
Gene name: | ADIPOR1 |
Gene alias: | ACDCR1|CGI-45|CGI45|FLJ25385|FLJ42464|PAQR1|TESBP1A |
Gene description: | adiponectin receptor 1 |
Genbank accession: | NM_015999 |
Immunogen: | ADIPOR1 (NP_057083.2, 72 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG |
Protein accession: | NP_057083.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADIPOR1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |