ADIPOR1 monoclonal antibody (M01), clone 2C8 View larger

ADIPOR1 monoclonal antibody (M01), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADIPOR1 monoclonal antibody (M01), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADIPOR1 monoclonal antibody (M01), clone 2C8

Brand: Abnova
Reference: H00051094-M01
Product name: ADIPOR1 monoclonal antibody (M01), clone 2C8
Product description: Mouse monoclonal antibody raised against a partial recombinant ADIPOR1.
Clone: 2C8
Isotype: IgG2b Kappa
Gene id: 51094
Gene name: ADIPOR1
Gene alias: ACDCR1|CGI-45|CGI45|FLJ25385|FLJ42464|PAQR1|TESBP1A
Gene description: adiponectin receptor 1
Genbank accession: NM_015999
Immunogen: ADIPOR1 (NP_057083.2, 72 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG
Protein accession: NP_057083.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051094-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ADIPOR1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADIPOR1 monoclonal antibody (M01), clone 2C8 now

Add to cart