YBX2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

YBX2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YBX2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about YBX2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00051087-D01P
Product name: YBX2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human YBX2 protein.
Gene id: 51087
Gene name: YBX2
Gene alias: CONTRIN|CSDA3|DBPC|MGC45104|MSY2
Gene description: Y box binding protein 2
Genbank accession: NM_015982.1
Immunogen: YBX2 (NP_057066.1, 1 a.a. ~ 364 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEVEAAAVATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
Protein accession: NP_057066.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051087-D01P-13-15-1.jpg
Application image note: Western Blot analysis of YBX2 expression in transfected 293T cell line (H00051087-T02) by YBX2 MaxPab polyclonal antibody.

Lane 1: YBX2 transfected lysate(38.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy YBX2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart