GAL monoclonal antibody (M01), clone 3C1-G5 View larger

GAL monoclonal antibody (M01), clone 3C1-G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GAL monoclonal antibody (M01), clone 3C1-G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GAL monoclonal antibody (M01), clone 3C1-G5

Brand: Abnova
Reference: H00051083-M01
Product name: GAL monoclonal antibody (M01), clone 3C1-G5
Product description: Mouse monoclonal antibody raised against a full-length recombinant GAL.
Clone: 3C1-G5
Isotype: IgG2a Kappa
Gene id: 51083
Gene name: GAL
Gene alias: GALN|GLNN|GMAP|MGC40167
Gene description: galanin prepropeptide
Genbank accession: BC030241
Immunogen: GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Protein accession: AAH30241
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051083-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.27 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051083-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged GAL is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GAL monoclonal antibody (M01), clone 3C1-G5 now

Add to cart