H00051082-D01P_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00051082-D01P |
Product name: | POLR1D purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human POLR1D protein. |
Gene id: | 51082 |
Gene name: | POLR1D |
Gene alias: | FLJ20616|MGC9850|POLR1C|RPA16|RPA9|RPAC2|RPO1-3 |
Gene description: | polymerase (RNA) I polypeptide D, 16kDa |
Genbank accession: | NM_015972.1 |
Immunogen: | POLR1D (NP_057056.1, 1 a.a. ~ 133 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Protein accession: | NP_057056.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR1D expression in transfected 293T cell line (H00051082-T02) by POLR1D MaxPab polyclonal antibody. Lane 1: POLR1D transfected lysate(15.20 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |