NOSIP purified MaxPab mouse polyclonal antibody (B01P) View larger

NOSIP purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NOSIP purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about NOSIP purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051070-B01P
Product name: NOSIP purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NOSIP protein.
Gene id: 51070
Gene name: NOSIP
Gene alias: CGI-25
Gene description: nitric oxide synthase interacting protein
Genbank accession: NM_015953.3
Immunogen: NOSIP (NP_057037.1, 1 a.a. ~ 301 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA
Protein accession: NP_057037.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00051070-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NOSIP expression in transfected 293T cell line (H00051070-T01) by NOSIP MaxPab polyclonal antibody.

Lane 1: NOSIP transfected lysate(33.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NOSIP purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart