SPG3A monoclonal antibody (M10), clone 1B11 View larger

SPG3A monoclonal antibody (M10), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPG3A monoclonal antibody (M10), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SPG3A monoclonal antibody (M10), clone 1B11

Brand: Abnova
Reference: H00051062-M10
Product name: SPG3A monoclonal antibody (M10), clone 1B11
Product description: Mouse monoclonal antibody raised against a partial recombinant SPG3A.
Clone: 1B11
Isotype: IgG1 Kappa
Gene id: 51062
Gene name: ATL1
Gene alias: AD-FSP|FSP1|GBP3|SPG3|SPG3A|atlastin1
Gene description: atlastin GTPase 1
Genbank accession: NM_015915
Immunogen: SPG3A (NP_056999, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Protein accession: NP_056999
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051062-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00051062-M10-1-19-1.jpg
Application image note: SPG3A monoclonal antibody (M10), clone 1B11. Western Blot analysis of SPG3A expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPG3A monoclonal antibody (M10), clone 1B11 now

Add to cart