Brand: | Abnova |
Reference: | H00051062-M03 |
Product name: | SPG3A monoclonal antibody (M03), clone 1B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPG3A. |
Clone: | 1B9 |
Isotype: | IgG1 Kappa |
Gene id: | 51062 |
Gene name: | ATL1 |
Gene alias: | AD-FSP|FSP1|GBP3|SPG3|SPG3A|atlastin1 |
Gene description: | atlastin GTPase 1 |
Genbank accession: | NM_015915 |
Immunogen: | SPG3A (NP_056999, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV |
Protein accession: | NP_056999 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | SPG3A monoclonal antibody (M03), clone 1B9 Western Blot analysis of SPG3A expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |