LAP3 monoclonal antibody (M02), clone 4G10 View larger

LAP3 monoclonal antibody (M02), clone 4G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAP3 monoclonal antibody (M02), clone 4G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr

More info about LAP3 monoclonal antibody (M02), clone 4G10

Brand: Abnova
Reference: H00051056-M02
Product name: LAP3 monoclonal antibody (M02), clone 4G10
Product description: Mouse monoclonal antibody raised against a partial recombinant LAP3.
Clone: 4G10
Isotype: IgG2a Kappa
Gene id: 51056
Gene name: LAP3
Gene alias: LAP|LAPEP|PEPS
Gene description: leucine aminopeptidase 3
Genbank accession: NM_015907
Immunogen: LAP3 (NP_056991, 420 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Protein accession: NP_056991
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051056-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged LAP3 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAP3 monoclonal antibody (M02), clone 4G10 now

Add to cart