LAP3 MaxPab rabbit polyclonal antibody (D01) View larger

LAP3 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAP3 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about LAP3 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00051056-D01
Product name: LAP3 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human LAP3 protein.
Gene id: 51056
Gene name: LAP3
Gene alias: LAP|LAPEP|PEPS
Gene description: leucine aminopeptidase 3
Genbank accession: NM_015907.2
Immunogen: LAP3 (NP_056991.2, 1 a.a. ~ 519 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Protein accession: NP_056991.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051056-D01-31-15-1.jpg
Application image note: Immunoprecipitation of LAP3 transfected lysate using anti-LAP3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LAP3 purified MaxPab mouse polyclonal antibody (B01P) (H00051056-B01P).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy LAP3 MaxPab rabbit polyclonal antibody (D01) now

Add to cart